PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn172721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 172aa    MW: 19311.7 Da    PI: 6.2843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn172721genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.24.9e-30110163155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp+LH+rFve+v++L G  +A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Achn172721 110 RPRLVWTPQLHKRFVEVVKHL-GVGNAVPKTIMQLMNVEGLTRENVASHLQKYRL 163
                 59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.274107166IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-30107167IPR009057Homeodomain-like
SuperFamilySSF466893.76E-20109167IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-24111163IPR006447Myb domain, plants
PfamPF002491.9E-9113162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGEEVRMSDY DGDNRVFEWE VGLPSAGDLT PLSQPLIPPE LASAFSISTE PRRSATDVNR  60
ASQNTLSAIS SSNNFNFKSL NDERSQEEFV EQGDEADLAR DGSDPRKEKR PRLVWTPQLH  120
KRFVEVVKHL GVGNAVPKTI MQLMNVEGLT RENVASHLQK YRLYLKRKQG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-21108167362ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491656.13e-72PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB45e-62PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0A0LXF66e-72A0A0A0LXF6_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g05120.t012e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.24e-62G2-like family protein